SLC10A1 Antibody

Name SLC10A1 Antibody
Supplier Novus Biologicals
Catalog NBP1-92393
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:CYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGE
Purity/Format Immunogen affinity purified
Blocking Peptide SLC10A1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC10A1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.