RPL13A Antibody

Name RPL13A Antibody
Supplier Novus Biologicals
Catalog NBP1-92345
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
Purity/Format Immunogen affinity purified
Blocking Peptide RPL13A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene RPL13A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.