SLC25A3 Antibody
| Name | SLC25A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92398 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGR |
| Description | Rabbit Polyclonal |
| Gene | SLC25A3 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SLC25A3 Antibody [NBP1-92398] Staining of human cell line U-251 MG shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29065_SLC25A3%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92398-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SLC25A3 Antibody [NBP1-92398] Staining of human cell line U-251 MG shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: SLC25A3 Antibody [NBP1-92398] - Staining of human salivary gland shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29066_SLC25A3%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92398-img0002.jpg)
Immunohistochemistry-Paraffin: SLC25A3 Antibody [NBP1-92398] - Staining of human salivary gland shows strong cytoplasmic and nuclear positivity in glandular cells.