ZNF564 Antibody
| Name | ZNF564 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92630 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FQRHERAHNGDKPYVKNVGKLSFITQPSNTCE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZNF564 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF564 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF564 Antibody [NBP1-92630] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25940_ZNF564-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92630-img0004.jpg)
Immunocytochemistry/Immunofluorescence: ZNF564 Antibody [NBP1-92630] - Staining of human cell line U-2 OS shows positivity in golgi apparatus.
![Immunohistochemistry-Paraffin: ZNF564 Antibody [NBP1-92630] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts..](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25941_ZNF564-Antibody-Immunohistochemistry-Paraffin-NBP1-92630-img0001.jpg)
Immunohistochemistry-Paraffin: ZNF564 Antibody [NBP1-92630] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts..
![Immunocytochemistry/Immunofluorescence: ZNF564 Antibody [NBP1-92630] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25942_ZNF564%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92630-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ZNF564 Antibody [NBP1-92630] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.