Syntaxin 16 Antibody
| Name | Syntaxin 16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92467 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Syntaxin 16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | STX16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Syntaxin 16 Antibody [NBP1-92467] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16964_Syntaxin%252016%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92467-img0008.jpg)
Immunocytochemistry/Immunofluorescence: Syntaxin 16 Antibody [NBP1-92467] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
![Immunohistochemistry-Paraffin: Syntaxin 16 Antibody [NBP1-92467] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16965_Syntaxin-16-Antibody-Immunohistochemistry-Paraffin-NBP1-92467-img0005.jpg)
Immunohistochemistry-Paraffin: Syntaxin 16 Antibody [NBP1-92467] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
![Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Simple Western lane view shows a specific band for Syntaxin 16 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16966_Syntaxin-16-Antibody-Simple-Western-NBP1-92467-img0006.jpg)
Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Simple Western lane view shows a specific band for Syntaxin 16 in 0.2 mg/ml of MCF-7 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
![Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Electropherogram image of the corresponding Simple Western lane view. Syntaxin 16 antibody was used at 1:100 dilution on MCF-7 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/16967_Syntaxin-16-Antibody-Simple-Western-NBP1-92467-img0007.jpg)
Simple Western: Syntaxin 16 Antibody [NBP1-92467] - Electropherogram image of the corresponding Simple Western lane view. Syntaxin 16 antibody was used at 1:100 dilution on MCF-7 lysate(s) respectively.