TMC2 Antibody

Name TMC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-92514
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:QVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRT
Purity/Format Immunogen affinity purified
Blocking Peptide TMC2 Protein
Description Rabbit Polyclonal
Gene TMC2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.