CCDC85A Antibody
| Name | CCDC85A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93565 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RHPHPGSSPETLPKHVLSGSPEHFQKHRSGSSPEHARHSGGSPEHLQKHALGGSLEHLPRARGTSPEHLKQHYGGSPDHKHGGGSGGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC85A Protein |
| Description | Rabbit Polyclonal |
| Gene | CCDC85A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: CCDC85A Antibody [NBP1-93565] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9813_CCDC85A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93565-img0003.jpg)
![Immunohistochemistry-Paraffin: CCDC85A Antibody [NBP1-93565] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9814_CCDC85A%2520Antibody-Immunohistochemistry-Paraffin-NBP1-93565-img0002.jpg)