C9orf72 Antibody
| Name | C9orf72 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93504 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf72 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C9orf72 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22232_C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP1-93504-img0005.jpg)
Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.