SEC14L5 Antibody
| Name | SEC14L5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93635 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AMKQYTANVKRGKEVIEHYLNELISQGTSHIPRWTPAPVREEDARNQAGPRDPSSLEAHGPRSTLGPALEAVSMDGDKLDADY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SEC14L5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SEC14L5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: SEC14L5 Antibody [NBP1-93635] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20113_SEC14L5-Antibody-Immunohistochemistry-Paraffin-NBP1-93635-img0002.jpg)
Immunohistochemistry-Paraffin: SEC14L5 Antibody [NBP1-93635] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.