KCT2 Antibody
| Name | KCT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93682 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IEEEDLLMLNSSPSTAKDTLDNGDYGEPDYDWTTGPRDDDESDDTLEENRGYMEIEQSVKSFKMPSSNIEEED |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KCT2 Protein |
| Description | Rabbit Polyclonal |
| Gene | C5orf15 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: KCT2 Antibody [NBP1-93682] - Staining of human cell line U-2 OS shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11759_KCT2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93682-img0003.jpg)
![Immunohistochemistry-Paraffin: KCT2 Antibody [NBP1-93682] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11760_KCT2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-93682-img0002.jpg)