C1orf172 Antibody
| Name | C1orf172 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93839 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FASSPRGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSDTVFLEKTSKISDLISSITQDYH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C1orf172 Protein |
| Description | Rabbit Polyclonal |
| Gene | KDF1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C1orf172 Antibody [NBP1-93839] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29636_C1orf172%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93839-img0002.jpg)
Immunocytochemistry/Immunofluorescence: C1orf172 Antibody [NBP1-93839] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: C1orf172 Antibody [NBP1-93839] - Immunohistochemical staining of human spleen shows distinct cytoplasmic and nuclear positivity in cells in red pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29637_C1orf172%2520Antibody-Immunohistochemistry-Paraffin-NBP1-93839-img0001.jpg)
Immunohistochemistry-Paraffin: C1orf172 Antibody [NBP1-93839] - Immunohistochemical staining of human spleen shows distinct cytoplasmic and nuclear positivity in cells in red pulp.