C11orf63 Antibody
| Name | C11orf63 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93927 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ELSDSDLEEKSSSLSPYVKSSSSHNEVFLPGSRGPRRRKSKQHFVEKNKLTLGLPTPKTDSYLQLHNKKRGESHPEQ |
| Description | Rabbit Polyclonal |
| Gene | C11orf63 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C11orf63 Antibody [NBP1-93927] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29702_C11orf63-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93927-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C11orf63 Antibody [NBP1-93927] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: C11orf63 Antibody [NBP1-93927] - Staining of human cervix, uterine shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29703_C11orf63-Antibody-Immunohistochemistry-Paraffin-NBP1-93927-img0005.jpg)
Immunohistochemistry-Paraffin: C11orf63 Antibody [NBP1-93927] - Staining of human cervix, uterine shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells.