UBN2 Antibody
| Name | UBN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93903 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DASSLTQVTKVHQHSAVQQNYVSPLQATISKSQTNPVVKLSNNPQLSCSSSLIKTSDKPLMYRLPLSTPSPGNGSQGSHPLVSRTVPSTTT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UBN2 Protein |
| Description | Rabbit Polyclonal |
| Gene | UBN2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/ Immunofluorescence: UBN2 Antibody [NBP1-93903] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2943_UBN2-Antibody-Immunocytochemistry--Immunofluorescence-NBP1-93903-img0004.jpg)
Immunocytochemistry/ Immunofluorescence: UBN2 Antibody [NBP1-93903] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: UBN2 Antibody [NBP1-93903] - Staining of human urinary bladder shows strong cytoplasmic positivity in endothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2944_UBN2-Antibody-Immunohistochemistry-Paraffin-NBP1-93903-img0005.jpg)
Immunohistochemistry-Paraffin: UBN2 Antibody [NBP1-93903] - Staining of human urinary bladder shows strong cytoplasmic positivity in endothelial cells.