C4orf27 Antibody

Name C4orf27 Antibody
Supplier Novus Biologicals
Catalog NBP1-93973
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB Simple Western ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:LVGPYDILAGKHKTKKKSTGLNFNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDEFPVYVGINEAKKNCIIVPNGDNVFAA
Purity/Format Immunogen affinity purified
Blocking Peptide C4orf27 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene C4orf27
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.