ZC2HC1B Antibody
| Name | ZC2HC1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-94081 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GNQELFPCEVCGRRFAADVLERHGPICKKLFNRKRKPFSSLKQRLQGTDIPTVK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZC2HC1B Protein |
| Description | Rabbit Polyclonal |
| Gene | ZC2HC1B |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZC2HC1B Antibody [NBP1-94081] - Staining of human cell line U-251MG shows positivity in nucleus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29796_ZC2HC1B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94081-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZC2HC1B Antibody [NBP1-94081] - Staining of human cell line U-251MG shows positivity in nucleus & vesicles.
![Immunohistochemistry-Paraffin: ZC2HC1B Antibody [NBP1-94081] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29797_ZC2HC1B%2520Antibody-Immunohistochemistry-Paraffin-NBP1-94081-img0002.jpg)
Immunohistochemistry-Paraffin: ZC2HC1B Antibody [NBP1-94081] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.