ZBTB8OS Antibody
| Name | ZBTB8OS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30520 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FQLQSIGWREEFSLSNHPQGTEVKVITYSAMQVYNKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZBTB8OS Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZBTB8OS |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZBTB8OS Antibody [NBP2-30520] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29879_ZBTB8OS-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30520-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ZBTB8OS Antibody [NBP2-30520] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli. Antibody staining is shown in green.
![Immunohistochemistry: ZBTB8OS Antibody [NBP2-30520] - Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29880_ZBTB8OS-Antibody-Immunohistochemistry-NBP2-30520-img0001.jpg)
Immunohistochemistry: ZBTB8OS Antibody [NBP2-30520] - Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.