CASC4 Antibody
| Name | CASC4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30507 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVSDFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CASC4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CASC4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CASC4 Antibody [NBP2-30507] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11185_CASC4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30507-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CASC4 Antibody [NBP2-30507] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
![Immunohistochemistry: CASC4 Antibody [NBP2-30507] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11186_CASC4-Antibody-Immunohistochemistry-NBP2-30507-img0001.jpg)
Immunohistochemistry: CASC4 Antibody [NBP2-30507] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.