VWCE Antibody
| Name | VWCE Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30504 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VWCE Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VWCE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: VWCE Antibody [NBP2-30504] - Staining of human cell line U-2 OS shows positivity in nucleus, plasma membrane and cytoplasm. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11145_VWCE-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30504-img0002.jpg)
Immunocytochemistry/Immunofluorescence: VWCE Antibody [NBP2-30504] - Staining of human cell line U-2 OS shows positivity in nucleus, plasma membrane and cytoplasm. Antibody staining is shown in green.
![Immunohistochemistry: VWCE Antibody [NBP2-30504] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11146_VWCE-Antibody-Immunohistochemistry-NBP2-30504-img0003.jpg)
Immunohistochemistry: VWCE Antibody [NBP2-30504] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.