GSKIP Antibody
| Name | GSKIP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30378 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GSKIP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GSKIP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GSKIP Antibody [NBP2-30378] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15247_GSKIP-Antibody-Western-Blot-NBP2-30378-img0003.jpg)
Western Blot: GSKIP Antibody [NBP2-30378] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: GSKIP Antibody [NBP2-30378] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15248_GSKIP%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30378-img0004.jpg)
Immunocytochemistry/Immunofluorescence: GSKIP Antibody [NBP2-30378] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & the Golgi apparatus.
![Immunohistochemistry: GSKIP Antibody [NBP2-30378] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15249_GSKIP-Antibody-Immunohistochemistry-NBP2-30378-img0001.jpg)
Immunohistochemistry: GSKIP Antibody [NBP2-30378] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.