DCUN1D5 Antibody
| Name | DCUN1D5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30432 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DCUN1D5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DCUN1D5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DCUN1D5 Antibody [NBP2-30432] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22160_DCUN1D5-Antibody-Western-Blot-NBP2-30432-img0002.jpg)
Western Blot: DCUN1D5 Antibody [NBP2-30432] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
![Immunocytochemistry/Immunofluorescence: DCUN1D5 Antibody [NBP2-30432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22161_DCUN1D5%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30432-img0005.jpg)
Immunocytochemistry/Immunofluorescence: DCUN1D5 Antibody [NBP2-30432] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & nucleoli.
![Immunohistochemistry: DCUN1D5 Antibody [NBP2-30432] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22162_DCUN1D5-Antibody-Immunohistochemistry-NBP2-30432-img0001.jpg)
Immunohistochemistry: DCUN1D5 Antibody [NBP2-30432] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.
![Simple Western: DCUN1D5 Antibody [NBP2-30432] - Simple Western lane view shows a specific band for DCUN1D5 in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22163_DCUN1D5-Antibody-Simple-Western-NBP2-30432-img0003.jpg)
Simple Western: DCUN1D5 Antibody [NBP2-30432] - Simple Western lane view shows a specific band for DCUN1D5 in 0.2 mg/ml of SW480 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.
![Simple Western: DCUN1D5 Antibody [NBP2-30432] - Electropherogram image of the corresponding Simple Western lane view. DCUN1D5 antibody was used at 1:10 dilution on SW480 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22164_DCUN1D5-Antibody-Simple-Western-NBP2-30432-img0004.jpg)
Simple Western: DCUN1D5 Antibody [NBP2-30432] - Electropherogram image of the corresponding Simple Western lane view. DCUN1D5 antibody was used at 1:10 dilution on SW480 lysate(s) respectively.