MIF4GD Antibody
| Name | MIF4GD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30627 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MIF4GD Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MIF4GD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MIF4GD Antibody [NBP2-30627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15884_MIF4GD-Antibody-Western-Blot-NBP2-30627-img0003.jpg)
Western Blot: MIF4GD Antibody [NBP2-30627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Tonsil
![Immunocytochemistry/Immunofluorescence: MIF4GD Antibody [NBP2-30627] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15885_MIF4GD%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30627-img0005.jpg)
Immunocytochemistry/Immunofluorescence: MIF4GD Antibody [NBP2-30627] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoli & cytosol.
![Immunohistochemistry: MIF4GD Antibody [NBP2-30627] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15886_MIF4GD-Antibody-Immunohistochemistry-NBP2-30627-img0001.jpg)
Immunohistochemistry: MIF4GD Antibody [NBP2-30627] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.