PRRT1 Antibody
| Name | PRRT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30641 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PRRT1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PRRT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PRRT1 Antibody [NBP2-30641] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15538_PRRT1-Antibody-Immunohistochemistry-Paraffin-NBP2-30641-img0003.jpg)
Immunohistochemistry-Paraffin: PRRT1 Antibody [NBP2-30641] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
![Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15539_PRRT1-Antibody-Immunohistochemistry-NBP2-30641-img0001.jpg)
Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Cerebral Cortex](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15540_PRRT1-Antibody-Immunohistochemistry-NBP2-30641-img0002.jpg)
Immunohistochemistry: PRRT1 Antibody [NBP2-30641] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Cerebral Cortex