SUMO-interacting Motif (SIM) Antibody
| Name | SUMO-interacting Motif (SIM) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30700 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SUMO-interacting Motif (SIM) Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SIMC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5611_SUMO-interacting-Motif-(SIM)-Antibody-Western-Blot-NBP2-30700-img0002.jpg)
Western Blot: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5612_SUMO-interacting%2520Motif%2520(SIM)%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30700-img0006.jpg)
Immunocytochemistry/Immunofluorescence: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus.
![Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Staining of human kidney shows cytoplasmic positivity in cells in tubules and in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/5613_SUMO-interacting-Motif-(SIM)-Antibody-Immunohistochemistry-Paraffin-NBP2-30700-img0005.jpg)
Immunohistochemistry-Paraffin: SUMO-interacting Motif (SIM) Antibody [NBP2-30700] - Staining of human kidney shows cytoplasmic positivity in cells in tubules and in glomeruli.