CRN Antibody
| Name | CRN Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30687 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RVRVIYKYALDRISKQDAQELFKNYTIFEKKFGDRRGIEDIIVSKRRFQYEEEVKANPHNYDAWFDYLRLVESDAEAEAVREVYERAIA |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CRNKL1 |
| Supplier Page | Shop |
![Western Blot: CRN Antibody [NBP2-30687] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Hep-G2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29986_CRN-Antibody-Western-Blot-NBP2-30687-img0002.jpg)
![Immunohistochemistry: CRN Antibody [NBP2-30687] - Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29987_CRN-Antibody-Immunohistochemistry-NBP2-30687-img0001.jpg)