FBXW12 Antibody
| Name | FBXW12 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30769 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBXW12 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FBXW12 |
| Supplier Page | Shop |
![Western Blot: FBXW12 Antibody [NBP2-30769] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29992_FBXW12-Antibody-Western-Blot-NBP2-30769-img0002.jpg)
![Immunohistochemistry: FBXW12 Antibody [NBP2-30769] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29993_FBXW12-Antibody-Immunohistochemistry-NBP2-30769-img0003.jpg)