APOA1BP Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-30943
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: APOA1BP Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: APOA1BP
• Conjugate: Unconjugated

Product images

Western Blot: APOA1BP Antibody [NBP2-30943] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: APOA1BP Antibody [NBP2-30943] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.

Immunohistochemistry: APOA1BP Antibody [NBP2-30943] - Staining in human kidney.