G gamma14 Antibody
| Name | G gamma14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56676 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit |
| Antigen | Synthetic peptides corresponding to GNGT2 The peptide sequence was selected from the middle region of GNGT2. Peptide sequence KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GNGT2 |
| Supplier Page | Shop |
Product images
![Western Blot: G gamma14 Antibody [NBP1-56676] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3633_G-gamma14-Antibody-Western-Blot-NBP1-56676-img0003.jpg)
Western Blot: G gamma14 Antibody [NBP1-56676] - 293T cells lysate, concentration 0.2-1 ug/ml.