Glyoxalase II/HAGH Antibody
| Name | Glyoxalase II/HAGH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56674 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HAGH(hydroxyacylglutathione hydrolase) The peptide sequence was selected from the C terminal of HAGH. Peptide sequence FARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HAGH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glyoxalase II/HAGH Antibody [NBP1-56674] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14645_Glyoxalase-II-HAGH-Antibody-Western-Blot-NBP1-56674-img0003.jpg)
Western Blot: Glyoxalase II/HAGH Antibody [NBP1-56674] - Human Liver cell lysate, concentration 0.2-1 ug/ml.