ASB11 Antibody

Name ASB11 Antibody
Supplier Novus Biologicals
Catalog NBP1-56673
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASB11(ankyrin repeat and SOCS box-containing 11) The peptide sequence was selected from the C terminal of ASB11. Peptide sequence GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASB11
Conjugate Unconjugated
Supplier Page Shop

Product images