Serine Dehydratase Antibody

Name Serine Dehydratase Antibody
Supplier Novus Biologicals
Catalog NBP1-56667
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SDS(serine dehydratase) The peptide sequence was selected from the N terminal of SDS (NP_006834) Peptide sequence AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SDS
Conjugate Unconjugated
Supplier Page Shop

Product images