WBP2 Antibody

Name WBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56661
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WBP2(WW domain binding protein 2) The peptide sequence was selected from the N terminal of WBP2. Peptide sequence MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WBP2
Conjugate Unconjugated
Supplier Page Shop

Product images