CCDC172 Antibody

Name CCDC172 Antibody
Supplier Novus Biologicals
Catalog NBP1-56398
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC172 The peptide sequence was selected from the middle region of CCDC172. Peptide sequence QRKLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC172
Conjugate Unconjugated
Supplier Page Shop

Product images