RPL10A Antibody

Name RPL10A Antibody
Supplier Novus Biologicals
Catalog NBP1-56386
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPL10A (ribosomal protein L10a) The peptide sequence was selected from the N terminal of RPL10A)(50ug). Peptide sequence MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPL10A
Conjugate Unconjugated
Supplier Page Shop

Product images