ZCCHC24 Antibody

Name ZCCHC24 Antibody
Supplier Novus Biologicals
Catalog NBP1-56437
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C10ORF56 The peptide sequence was selected from the middle region of C10ORF56. Peptide sequence LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZCCHC24
Conjugate Unconjugated
Supplier Page Shop

Product images