FUNDC1 Antibody

Name FUNDC1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56430
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FUNDC1(FUN14 domain containing 1) The peptide sequence was selected from the middle region of FUNDC1. Peptide sequence TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FUNDC1
Conjugate Unconjugated
Supplier Page Shop

Product images