PFDN6 Antibody

Name PFDN6 Antibody
Supplier Novus Biologicals
Catalog NBP1-56417
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Sheep, Zebrafish
Antigen Synthetic peptides corresponding to PFDN6(prefoldin subunit 6) The peptide sequence was selected from the N terminal of PFDN6. Peptide sequence MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PFDN6
Supplier Page Shop

Product images