Name | PFDN6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56417 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Sheep, Zebrafish |
Antigen | Synthetic peptides corresponding to PFDN6(prefoldin subunit 6) The peptide sequence was selected from the N terminal of PFDN6. Peptide sequence MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PFDN6 |
Supplier Page | Shop |