FBXO39 Antibody

Name FBXO39 Antibody
Supplier Novus Biologicals
Catalog NBP1-56491
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to FBXO39(F-box protein 39) The peptide sequence was selected from the middle region of FBXO39. Peptide sequence RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FBXO39
Supplier Page Shop

Product images