FBXO39 Antibody

Name FBXO39 Antibody
Supplier Novus Biologicals
Catalog NBP1-56490
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO39(F-box protein 39) The peptide sequence was selected from the N terminal of FBXO39. Peptide sequence DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO39
Conjugate Unconjugated
Supplier Page Shop

Product images