C11orf57 Antibody

Name C11orf57 Antibody
Supplier Novus Biologicals
Catalog NBP1-56475
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C11ORF57 The peptide sequence was selected from the middle region of C11ORF57. Peptide sequence RWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C11orf57
Conjugate Unconjugated
Supplier Page Shop

Product images