STX19 Antibody

Name STX19 Antibody
Supplier Novus Biologicals
Catalog NBP1-56467
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to STX19(syntaxin 19) The peptide sequence was selected from the N terminal of STX19 (NP_001001850). Peptide sequence LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene STX19
Conjugate Unconjugated
Supplier Page Shop

Product images