RWDD4A Antibody

Name RWDD4A Antibody
Supplier Novus Biologicals
Catalog NBP1-56461
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RWDD4A(RWD domain containing 4A) The peptide sequence was selected from the middle region of RWDD4A. Peptide sequence SSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RWDD4
Conjugate Unconjugated
Supplier Page Shop

Product images