FBXO42 Antibody

Name FBXO42 Antibody
Supplier Novus Biologicals
Catalog NBP1-56643
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog, Horse
Antigen Synthetic peptides corresponding to FBXO42(F-box protein 42) The peptide sequence was selected from the middle region of FBXO42. Peptide sequence RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FBXO42
Supplier Page Shop

Product images