TCAP Antibody

Name TCAP Antibody
Supplier Novus Biologicals
Catalog NBP1-56626
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TCAP(titin-cap (telethonin)) The peptide sequence was selected from the middle region of TCAP. Peptide sequence IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene TCAP
Conjugate Unconjugated
Supplier Page Shop

Product images