MDP1 Antibody
| Name | MDP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56573 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MDP-1 The peptide sequence was selected from the N terminal of MDP-1. Peptide sequence MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MDP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MDP1 Antibody [NBP1-56573] - Hela Cell Lysate 1.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7454_MDP1%2520Antibody-Western%2520Blot-NBP1-56573-img0002.jpg)
![Western Blot: MDP1 Antibody [NBP1-56573] - HT1080 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7455_MDP1%2520Antibody-Western%2520Blot-NBP1-56573-img0001.jpg)