NECAB3 Antibody
| Name | NECAB3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56552 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NECAB3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NECAB3 Antibody [NBP1-56552] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7444_NECAB3-Antibody-Western-Blot-NBP1-56552-img0002.jpg)
Western Blot: NECAB3 Antibody [NBP1-56552] - Hela cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: NECAB3 Antibody [NBP1-56552] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate NECAB3 is supported by BioGPS gene expression data to be expressed in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7445_NECAB3%2520Antibody-Western%2520Blot-NBP1-56552-img0003.jpg)
Western Blot: NECAB3 Antibody [NBP1-56552] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate NECAB3 is supported by BioGPS gene expression data to be expressed in HeLa.