RGS22 Antibody

Name RGS22 Antibody
Supplier Novus Biologicals
Catalog NBP1-56546
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RGS22(regulator of G-protein signaling 22) The peptide sequence was selected from the N terminal of RGS22. Peptide sequence QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RGS22
Conjugate Unconjugated
Supplier Page Shop

Product images