CCDC25 Antibody

Name CCDC25 Antibody
Supplier Novus Biologicals
Catalog NBP1-56660
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCDC25(coiled-coil domain containing 25) The peptide sequence was selected from the middle region of CCDC25. Peptide sequence DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCDC25
Conjugate Unconjugated
Supplier Page Shop

Product images