LRIF1 Antibody

Name LRIF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56659
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1ORF103 The peptide sequence was selected from the middle region of C1ORF103. Peptide sequence SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRIF1
Conjugate Unconjugated
Supplier Page Shop

Product images