FAM190A Antibody

Name FAM190A Antibody
Supplier Novus Biologicals
Catalog NBP1-56658
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MGC48628(similar to KIAA1680 protein) The peptide sequence was selected from the N terminal of MGC48628. Peptide sequence HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCSER1
Conjugate Unconjugated
Supplier Page Shop

Product images