ACTR3B Antibody

Name ACTR3B Antibody
Supplier Novus Biologicals
Catalog NBP1-56602
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Dog, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B. Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ACTR3B
Supplier Page Shop

Product images