Name | ACTR3B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56602 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Dog, Horse, Guinea Pig |
Antigen | Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B. Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ACTR3B |
Supplier Page | Shop |